Protein Labeling Reagents
CPC Scientific FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C215H305N53O64S1MOLECULAR WEIGHT:4688.2STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1678416-08-4], SYNONYMS: 5-FAM-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Revvity Health Sciences Inc HTRF Anti-Europium NHS Labeling Reagent, 100 µg
HTRF Anti-Europium NHS Labeling Reagent, 100 µg
Medchemexpress LLC Cy5-PEG3-azide | 00-00-0 | C40H55ClN6O4 | 10MG
Cy5-PEG3-azide is a Cy5-labeled PEG3 azide reagent for click-chemistry labeling and linker applications. It enables copper-catalyzed azide-alkyne cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) to attach Cy5 fluorescence to alkyne-bearing molecules for bioconjugation, imaging, and PROTAC synthesis.
- Provides Cy5 fluorescence for detection and imaging.
- Contains a PEG3 spacer to improve solubility and reduce steric hindrance.
- Reactive azide functional group for CuAAC and SPAAC conjugations.
- Supplied as a dry powder for convenient storage and handling.
- Store protected from light at -20°C; in solvent, store at -80°C for long-term.
STA PHARMACEUTICAL US LLC Fmoc-L-Lys(5-FAM)-OH | 1 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 1 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 15 mL HDPE
- Pack Size: 1 g
- Net Weight: 1 g
- Gross Weight: 7.8 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 1MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
CPC Scientific 5FAM-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: 5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C164H256N50O48S4MOLECULAR WEIGHT:3824.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
STA PHARMACEUTICAL US LLC Fmoc-L-Lys(5-FAM)-OH | 25 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 25 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 125 mL HDPE
- Pack Size: 25 g
- Net Weight: 25 g
- Gross Weight: 54.3 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
Medchemexpress LLC Cyanine2 succinimidyl ester (iodine) | 186205-33-4 | 98.1% | 643.47 g/mol | C29H30IN3O6 | 10 MG
Cy2-SE (iodine) is an iodinated Cyanine2 succinimidyl ester fluorescent labeling reagent used for amine-reactive conjugation to proteins, antibodies, and small molecules. It provides strong absorption and emission characteristics typical of cyanine dyes, with high extinction coefficient and good water solubility.
- Amine-reactive succinimidyl ester for stable protein conjugation.
- Suitable for labeling antibodies and small biomolecules.
- High purity (98.11%) for consistent conjugation performance.
- Molecular weight 643.47 g/mol; chemical formula C29H30IN3O6.
- Analytical support available: data sheet, COA, SDS, and spectral data.
Apexbio Technology LLC Cy3 NHS ester, 25mg. Cas: MFCD: MFCD28505569. Labeling of amino-groups in biomolecules.
Sulfo-Cy3 NHS ester is a sulfonated, hydrophilic and highly water soluble dye. For labeling proteins and peptides, no organic co-solvent is needed. Other sizes are available. Please inqury us for quote.
Medchemexpress LLC HY-66021 100mg Medchemexpress, 6-FAM CAS:3301-79-9 Purity:>98%
Medchemexpress, HY-66021 100mg 6-FAM CAS:3301-79-9 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Revvity Health Sciences Inc IVISense 680 MAL Fluorescent Dye (1 mg) (VivoTag)
IVISense 680 MAL Fluorescent Dye (1 mg) (VivoTag)
Revvity Health Sciences Inc HTRF Anti-Europium NH2 Labeling Reagent, 1 mg
HTRF Anti-Europium NH2 Labeling Reagent, 1 mg
STA PHARMACEUTICAL US LLC Fmoc-L-Lys(5-FAM)-OH | 100 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 100 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 500 mL HDPE
- Pack Size: 100 g
- Net Weight: 100 g
- Gross Weight: 160.5 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
LICOR IRDye 680RD Carboxylate (100 nmol)
Assays that use IRDye 680RD conjugates (such as small animal imaging and cell binding assays) may require a "dye-only" control for potential effects or retention of the dye. Carboxylate (non-reactive) form of IRDye 680RD is an ideal control.
Medchemexpress LLC HY-15939 10mg Medchemexpress, 6-FAM SE CAS:92557-81-8 Purity:>98%
Medchemexpress, HY-15939 10mg 6-FAM SE CAS:92557-81-8 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.